Gems from USHUPO 2009

March 1st, 2009

USHUPO 2009 just finished days ago here in San Diego. I attended this conference and here are what I thought some gems from the conference.

  • Albert Heck from The Netherlands presented the use of a new endoprotease LysN combining with ETD mass spectrometer for de novo peptide sequencing. They got nice ladders of C ions that could be read easily to derive sequences.
  • Christine Wu from University of Colorado presented a talk on doing LC at elevated temperature (60 degree C) for better separation and identification of membrane peptides and proteins. This is not totally new. Last time in 2007 they showed identification of ~100 proteins but this time they scaled up to ~1,100 proteins.
  • Brian Halligan from Medical College of Wisconsin presented an implementation of Amazon Web Services (AWS) for tandem mass spectrometry data analysis using XTandem and OMSSA. See here for more details. The cost (charged by Amazon.com) for analyzing each data set is $0.84 (will depend on size of data), according to what they said. That could be quite helpful for some laboratories that do not have large computational power. I think I will try it out sometime.

Just a side note, I did not go to all the sessions, so I might miss some excellent talks. Nevertheless, I was impressed and entertained by these three talks.


What is ‘food’?

October 8th, 2008

Following is a joke I translated from Chinese. It is related to a remark made today by Horace Engdahl, a figure of authority at the Swedish Academy, regarding the 2008 Nobel Prize for Literature. He commented that the Americans are too isolated from the world in term of literature.

Actually, different parts of the world are so quite different. Many times I am feeling very lucky and blessed, comparing with people from other corners of the world.

OK, here is the joke:

Reporter: What is your personal opinion on international food deficiency?

American: What is international?
Swiss: What is deficiency?
Ethiopian: What is food?
Cuban: What is personal?
North Korean: What is opinion?

Reference

http://www.cafebabel.com/eng/article/26676/nobel-literature-prize-horace-engdahl.html


Is work your play?

August 23rd, 2008

One powerful thing is called attitude. After reading the following paragraph by Claude Hopkins, I think I can not agree more than what he said. Work is a play, isn’t it?

“If a thing is useful they call it work, if useless they call it play. One is as hard as the other. One can be just as much a game as the other… All the difference I see lies in attitude of mind… I came to love work as other men love golf. I love it still. Many a time I beg off from a bridge game, a dinner, or a dance to spend the evening in my office. I steal away from weekend parties at my country home to enjoy a few hours at my typewriter.” –Claude C. Hopkins


What are spectral counts

August 14th, 2008

This post is written mostly for people who are new to the proteomics field.

Spectral counts are the number of tandem mass spectra (MS/MS) that are matched to the peptides for a protein. It is sometimes used as an indicator of protein abundance. Spectral counting is one widely used label-free protein quantitation method by mass spectrometry approach. It was first proposed by Liu et al (2004).

Example: For the following protein:
>gi|30794280|ref|NP_851335.1| albumin [Bos taurus]
MKWVTFISLLLLFSSAYSRGVFRRDTHKSEIAHRFK
DLGEEHFKGLVLIAFSQYLQQCPFDEHVKLVNELTE
FAKTCVADESHAGCEKSLHTLFGDELCKVASLRET
YGDMADCCEKQEPERNECFLSHKDDSPDLPKLKPD
PNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELL
YYANKYNGVFQECCQAEDKGACLLPKIETMREKVL
TSSARQRLRCASIQKFGERALKAWSVARLSQKFPK
AEFVEVTKLVTDLTKVHKECCHGDLLECADDRADLA
KYICDNQDTISSKLKECCDKPLLEKSHCIAEVEKDAI
PENLPPLTADFAEDKDVCKNYQEAKDAFLGSFLYEY
SRRHPEYAVSVLLRLAKEYEATLEECCAKDDPHACY
STVFDKLKHLVDEPQNLIKQNCDQFEKLGEYGFQNA
LIVRYTRKVPQVSTPTLVEVSRSLGKVGTRCCTKPE
SERMPCTEDYLSLILNRLCVLHEKTPVSEKVTKCCT
ESLVNRRPCFSALTPDETYVPKAFDEKLFTFHADIC
TLPDTEKQIKKQTALVELLKHKPKATEEQLKTVMEN
FVAFVDKCCAADDKEACFAVEGPKLVVSTQTALA

A tandem mass spectrometry experiment identified the peptides “GVFRRDTHKSEIAHRFK” and “EYEATLEECCAK”. The peptide “GVFRRDTHKSEIAHRFK” was matched by 3 separate tandem mass spectra, while the peptide “EYEATLEECCAK” was matched by 2 separate tandem mass spectra. No other peptide from this protein was matched by tandem mass spectra. The overall spectral counts for this protein is 2+3 = 5.

Reference

Liu H, Sadygov RG, Yates JR 3rd. A model for random sampling and estimation of relative protein abundance in shotgun proteomics. Anal Chem. 2004 Jul 15;76(14):4193-201.


Spectral counting normalization methods

July 31st, 2008

Spectral counting can be used for protein quantification in two scenarios.

In the first scenario, protein abundances are compared across experiments for the same proteins. For example, the abundance of Protein1 in experiment S1 is compared to that of experiment S2. Spectral counts normalization is relatively simple in this scenario – we just need to make sure that after normalization, the sum of total spectral counts t1 for all the identified proteins in experiment S1 equals the total spectral counts t2 for all the identified proteins in experiment S2. One straightforward normalization formula is, for each protein, the normalized spectral count f1 for the protein in experiment S1 and f2 for the protein in experiment S2 are,

where n1 is the un-normalized spectral count for the protein in experiment S1, n2 is the un-normalized spectral count for the same protein in experiment S2.

In the second scenario, protein abundances are compared within a single experiment. For example, the abundance of Protein1 is compared to the abundance of Protein2. In this scenario, it was suggested that protein length should also be taken into consideration when doing spectral counting normalization (Zybailov et al., 2006). The reason is that, for proteins of the same abundance, longer protein might have more number of spectral counts. In such a scenario, the following formula can be used for normalization:

where L is the length of the protein. Using such formulas, the sum of all f1 and the sum of all f2 will each equal to 1. Note that because the sum of all f1 equals the sum of all f2 (=1), this normalization can also be used to compare spectral counts across experiments.

The normalized spectral counts will then be used by statistical methods to see if the abundance is different for the interested protein(s). To avoid taking logarithm on zero’s when performing statistical tests, a special measure need to be taken. This special measure is to add a “pseudo count” to the spectral count for each protein. After considering pseudo count, the above formulas are now as following:

For comparing protein abundances only across experiments:

For comparing protein abundances within a single experiment or across experiments:

Reference

Zybailov B, Mosley AL, Sardiu ME, Coleman MK, Florens L, Washburn MP. (2006) Statistical analysis of membrane proteome expression changes in Saccharomyces cerevisiae. J Proteome Res. 5: 2339-2347.

Also see Tutorial on protein quantification using spectral counting G test


Access subfolders with WordPress installed at root folder

July 29th, 2008

When WordPress is installed at the root folder, and the permalink is set up using only “postname”, it might be impossible to access subfolders under the root folder, as stated by Using WordPress Permalink.

I figured out a way to deal with such a situation. My solution is to create a subdomain with the same name as that of the subfolder. The subfolder now can be accessed through the subdomain.

For example, it is impossible for me to access my subfolder http://www.lubw.com/files/. However, it is fine for me to access my subdomain http://files.lubw.com/.


Confront a problem

July 24th, 2008

Two random quotes on how to be successful.

“When you confront a problem, you begin to solve it.” — Rudy Giuliani (Former Mayor of NY City)

“I’ve found that luck is quite predictable. If you want more luck, take more chances, be more active, show up more often.” — Brian Tracy


InnoCentive connects solvers to problems

July 22nd, 2008

In this world, there are always problems to be solved. This website, InnoCentive, provides an opportunity for people to expose their problems to a large pool of people of different expertise all over the world.

And if you are someone who likes challenging problems, you can sign up as a problem solver to try to solve other people’s problem. It is even better that if you really solve other people’s problems, you will win cash awards. The awards are ranging from US$5,000 to US$1,000,000.

References

http://www.innocentive.com/

NY Times: If you have a problem, ask everyone


What is R21 grant

July 21st, 2008

The R21 grant is a type of United States National Institute of Health Grant. R21 is intended to encourage exploratory/developmental research projects by providing support for the early and conceptual stages of development.

Some Characteristics of R21 Application

  • Project period can be of up to two years
  • The combined budget for direct costs for the two year project period may not exceed $275,000.
  • R21 grant support is for new projects only; competing renewal applications will not be accepted.
  • Two resubmissions of a previously reviewed exploratory/developmental grant application may be submitted as defined in NIH Policy at http://grants.nih.gov/grants/policy/amendedapps.htm.
  • Introduction (required for a resubmission application) is limited to one page.
  • Items 2-5 of the Research Plan (Specific Aims, Background and Significance, Preliminary Studies, and Research Design and Methods) may not exceed a total of 15 pages.
  • No preliminary data is required but may be included if available.
  • A Progress Report is not needed.
  • Use the instructions for the appendix detailed in the SF424 (R&R) except that no more than 5 manuscripts, previously accepted for publication, may be included.

Reference
NIH Exploratory/Developmental Research Grant Award - R21 Grant


G-test table :: Chi-square table

July 21st, 2008

To compare protein expression between two experiments using spectral counting G-test, we use the chi-square table with one degree of freedom. The significance is assessed according to the upper critical values of chi-square distribution. Following we give the chi-square tables with different kinds of degrees of freedom at various critical values. For more information on “chi-square tables”, please see http://www.itl.nist.gov/div898/handbook/eda/section3/eda3674.htm

Upper critical values of chi-square distribution with n degrees of freedom.

Probability of exceeding the critical value:

n 0.10 0.05 0.025 0.01 0.001
1 2.706 3.841 5.024 6.635 10.828
2 4.605 5.991 7.378 9.210 13.816
3 6.251 7.815 9.348 11.345 16.266
4 7.779 9.488 11.143 13.277 18.467
5 9.236 11.070 12.833 15.086 20.515
6 10.645 12.592 14.449 16.812 22.458
7 12.017 14.067 16.013 18.475 24.322
8 13.362 15.507 17.535 20.090 26.125
9 14.684 16.919 19.023 21.666 27.877
10 15.987 18.307 20.483 23.209 29.588
11 17.275 19.675 21.920 24.725 31.264
12 18.549 21.026 23.337 26.217 32.910
13 19.812 22.362 24.736 27.688 34.528
14 21.064 23.685 26.119 29.141 36.123
15 22.307 24.996 27.488 30.578 37.697
16 23.542 26.296 28.845 32.000 39.252
17 24.769 27.587 30.191 33.409 40.790
18 25.989 28.869 31.526 34.805 42.312
19 27.204 30.144 32.852 36.191 43.820
20 28.412 31.410 34.170 37.566 45.315
21 29.615 32.671 35.479 38.932 46.797
22 30.813 33.924 36.781 40.289 48.268
23 32.007 35.172 38.076 41.638 49.728
24 33.196 36.415 39.364 42.980 51.179
25 34.382 37.652 40.646 44.314 52.620
26 35.563 38.885 41.923 45.642 54.052
27 36.741 40.113 43.195 46.963 55.476
28 37.916 41.337 44.461 48.278 56.892
29 39.087 42.557 45.722 49.588 58.301
30 40.256 43.773 46.979 50.892 59.703
31 41.422 44.985 48.232 52.191 61.098
32 42.585 46.194 49.480 53.486 62.487
33 43.745 47.400 50.725 54.776 63.870
34 44.903 48.602 51.966 56.061 65.247
35 46.059 49.802 53.203 57.342 66.619
36 47.212 50.998 54.437 58.619 67.985
37 48.363 52.192 55.668 59.893 69.347
38 49.513 53.384 56.896 61.162 70.703
39 50.660 54.572 58.120 62.428 72.055
40 51.805 55.758 59.342 63.691 73.402
41 52.949 56.942 60.561 64.950 74.745
42 54.090 58.124 61.777 66.206 76.084
43 55.230 59.304 62.990 67.459 77.419
44 56.369 60.481 64.201 68.710 78.750
45 57.505 61.656 65.410 69.957 80.077
46 58.641 62.830 66.617 71.201 81.400
47 59.774 64.001 67.821 72.443 82.720
48 60.907 65.171 69.023 73.683 84.037
49 62.038 66.339 70.222 74.919 85.351
50 63.167 67.505 71.420 76.154 86.661
51 64.295 68.669 72.616 77.386 87.968
52 65.422 69.832 73.810 78.616 89.272
53 66.548 70.993 75.002 79.843 90.573
54 67.673 72.153 76.192 81.069 91.872
55 68.796 73.311 77.380 82.292 93.168
56 69.919 74.468 78.567 83.513 94.461
57 71.040 75.624 79.752 84.733 95.751
58 72.160 76.778 80.936 85.950 97.039
59 73.279 77.931 82.117 87.166 98.324
60 74.397 79.082 83.298 88.379 99.607
61 75.514 80.232 84.476 89.591 100.888
62 76.630 81.381 85.654 90.802 102.166
63 77.745 82.529 86.830 92.010 103.442
64 78.860 83.675 88.004 93.217 104.716
65 79.973 84.821 89.177 94.422 105.988
66 81.085 85.965 90.349 95.626 107.258
67 82.197 87.108 91.519 96.828 108.526
68 83.308 88.250 92.689 98.028 109.791
69 84.418 89.391 93.856 99.228 111.055
70 85.527 90.531 95.023 100.425 112.317
71 86.635 91.670 96.189 101.621 113.577
72 87.743 92.808 97.353 102.816 114.835
73 88.850 93.945 98.516 104.010 116.092
74 89.956 95.081 99.678 105.202 117.346
75 91.061 96.217 100.839 106.393 118.599
76 92.166 97.351 101.999 107.583 119.850
77 93.270 98.484 103.158 108.771 121.100
78 94.374 99.617 104.316 109.958 122.348
79 95.476 100.749 105.473 111.144 123.594
80 96.578 101.879 106.629 112.329 124.839
81 97.680 103.010 107.783 113.512 126.083
82 98.780 104.139 108.937 114.695 127.324
83 99.880 105.267 110.090 115.876 128.565
84 100.980 106.395 111.242 117.057 129.804
85 102.079 107.522 112.393 118.236 131.041
86 103.177 108.648 113.544 119.414 132.277
87 104.275 109.773 114.693 120.591 133.512
88 105.372 110.898 115.841 121.767 134.746
89 106.469 112.022 116.989 122.942 135.978
90 107.565 113.145 118.136 124.116 137.208
91 108.661 114.268 119.282 125.289 138.438
92 109.756 115.390 120.427 126.462 139.666
93 110.850 116.511 121.571 127.633 140.893
94 111.944 117.632 122.715 128.803 142.119
95 113.038 118.752 123.858 129.973 143.344
96 114.131 119.871 125.000 131.141 144.567
97 115.223 120.990 126.141 132.309 145.789
98 116.315 122.108 127.282 133.476 147.010
99 117.407 123.225 128.422 134.642 148.230
100 118.498 124.342 129.561 135.807 149.449
100 118.498 124.342 129.561 135.807 149.449

Lower critical values of chi-square distribution with n degrees of freedom

Probability of exceeding the critical value

n 0.90 0.95 0.975 0.99 0.999
1. .016 .004 .001 .000 .000
2. .211 .103 .051 .020 .002
3. .584 .352 .216 .115 .024
4. 1.064 .711 .484 .297 .091
5. 1.610 1.145 .831 .554 .210
6. 2.204 1.635 1.237 .872 .381
7. 2.833 2.167 1.690 1.239 .598
8. 3.490 2.733 2.180 1.646 .857
9. 4.168 3.325 2.700 2.088 1.152
10. 4.865 3.940 3.247 2.558 1.479
11. 5.578 4.575 3.816 3.053 1.834
12. 6.304 5.226 4.404 3.571 2.214
13. 7.042 5.892 5.009 4.107 2.617
14. 7.790 6.571 5.629 4.660 3.041
15. 8.547 7.261 6.262 5.229 3.483
16. 9.312 7.962 6.908 5.812 3.942
17. 10.085 8.672 7.564 6.408 4.416
18. 10.865 9.390 8.231 7.015 4.905
19. 11.651 10.117 8.907 7.633 5.407
20. 12.443 10.851 9.591 8.260 5.921
21. 13.240 11.591 10.283 8.897 6.447
22. 14.041 12.338 10.982 9.542 6.983
23. 14.848 13.091 11.689 10.196 7.529
24. 15.659 13.848 12.401 10.856 8.085
25. 16.473 14.611 13.120 11.524 8.649
26. 17.292 15.379 13.844 12.198 9.222
27. 18.114 16.151 14.573 12.879 9.803
28. 18.939 16.928 15.308 13.565 10.391
29. 19.768 17.708 16.047 14.256 10.986
30. 20.599 18.493 16.791 14.953 11.588
31. 21.434 19.281 17.539 15.655 12.196
32. 22.271 20.072 18.291 16.362 12.811
33. 23.110 20.867 19.047 17.074 13.431
34. 23.952 21.664 19.806 17.789 14.057
35. 24.797 22.465 20.569 18.509 14.688
36. 25.643 23.269 21.336 19.233 15.324
37. 26.492 24.075 22.106 19.960 15.965
38. 27.343 24.884 22.878 20.691 16.611
39. 28.196 25.695 23.654 21.426 17.262
40. 29.051 26.509 24.433 22.164 17.916
41. 29.907 27.326 25.215 22.906 18.575
42. 30.765 28.144 25.999 23.650 19.239
43. 31.625 28.965 26.785 24.398 19.906
44. 32.487 29.787 27.575 25.148 20.576
45. 33.350 30.612 28.366 25.901 21.251
46. 34.215 31.439 29.160 26.657 21.929
47. 35.081 32.268 29.956 27.416 22.610
48. 35.949 33.098 30.755 28.177 23.295
49. 36.818 33.930 31.555 28.941 23.983
50. 37.689 34.764 32.357 29.707 24.674
51. 38.560 35.600 33.162 30.475 25.368
52. 39.433 36.437 33.968 31.246 26.065
53. 40.308 37.276 34.776 32.018 26.765
54. 41.183 38.116 35.586 32.793 27.468
55. 42.060 38.958 36.398 33.570 28.173
56. 42.937 39.801 37.212 34.350 28.881
57. 43.816 40.646 38.027 35.131 29.592
58. 44.696 41.492 38.844 35.913 30.305
59. 45.577 42.339 39.662 36.698 31.020
60. 46.459 43.188 40.482 37.485 31.738
61. 47.342 44.038 41.303 38.273 32.459
62. 48.226 44.889 42.126 39.063 33.181
63. 49.111 45.741 42.950 39.855 33.906
64. 49.996 46.595 43.776 40.649 34.633
65. 50.883 47.450 44.603 41.444 35.362
66. 51.770 48.305 45.431 42.240 36.093
67. 52.659 49.162 46.261 43.038 36.826
68. 53.548 50.020 47.092 43.838 37.561
69. 54.438 50.879 47.924 44.639 38.298
70. 55.329 51.739 48.758 45.442 39.036
71. 56.221 52.600 49.592 46.246 39.777
72. 57.113 53.462 50.428 47.051 40.519
73. 58.006 54.325 51.265 47.858 41.264
74. 58.900 55.189 52.103 48.666 42.010
75. 59.795 56.054 52.942 49.475 42.757
76. 60.690 56.920 53.782 50.286 43.507
77. 61.586 57.786 54.623 51.097 44.258
78. 62.483 58.654 55.466 51.910 45.010
79. 63.380 59.522 56.309 52.725 45.764
80. 64.278 60.391 57.153 53.540 46.520
81. 65.176 61.261 57.998 54.357 47.277
82. 66.076 62.132 58.845 55.174 48.036
83. 66.976 63.004 59.692 55.993 48.796
84. 67.876 63.876 60.540 56.813 49.557
85. 68.777 64.749 61.389 57.634 50.320
86. 69.679 65.623 62.239 58.456 51.085
87. 70.581 66.498 63.089 59.279 51.850
88. 71.484 67.373 63.941 60.103 52.617
89. 72.387 68.249 64.793 60.928 53.386
90. 73.291 69.126 65.647 61.754 54.155
91. 74.196 70.003 66.501 62.581 54.926
92. 75.100 70.882 67.356 63.409 55.698
93. 76.006 71.760 68.211 64.238 56.472
94. 76.912 72.640 69.068 65.068 57.246
95. 77.818 73.520 69.925 65.898 58.022
96. 78.725 74.401 70.783 66.730 58.799
97. 79.633 75.282 71.642 67.562 59.577
98. 80.541 76.164 72.501 68.396 60.356
99. 81.449 77.046 73.361 69.230 61.137
100. 82.358 77.929 74.222 70.065 61.918

Reference

http://www.itl.nist.gov/div898/handbook/eda/section3/eda3674.htm